The domain within your query sequence starts at position 114 and ends at position 273; the E-value for the DUF3361 domain shown below is 5.6e-77.
VTFATEFINMDGIIVLTRLVESGTKLLSHYSEMLAFTLTAFLELMDHGIVSWDMVSVTFI KQIAGYVSQPMVDVSILQRSLAILESMVLNSQSLYQKIAEEITVGQLISHLQVSNQEIQT YAIALINALFLKAPEDKRQDMANAFAQKHLRSIILNHVIR
DUF3361 |
![]() |
---|
PFAM accession number: | PF11841 |
---|---|
Interpro abstract (IPR024574): | This domain is functionally uncharacterised. This domain is found in eukaryotes and predominantly in ELMO (Engulfment and cell motility) proteins where it may play an important role in defining the functions of the ELMO family members and may be functionally linked to the ELMO domain in these proteins [ (PUBMED:23014990) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3361