The domain within your query sequence starts at position 228 and ends at position 353; the E-value for the DUF3371 domain shown below is 9.2e-36.

MQARAHGLSLIPSTGLCSPDLVNRIIKQEPVLENCSQELVQHQADLTCTTTLDLTDGTIT
FTNNLGTMPESSPAYSIPRKMGSNLEDILMDDALSPVGVTDPLLSSVSPGASKTSSRRSS
MSAEET

DUF3371

 DUF3371
PFAM accession number:PF11851
Interpro abstract (IPR021802):

This entry represents a domain found at the C terminus of the MiT/TFE family members, which include MITF (microphthalmia-associated transcription factor) and its related family members TFE3, TFEB and TFEC [ (PUBMED:7958932) ]. They are basic helix-loop-helix leucine zipper transcription factors found in chordata. These transcription factors heterodimerize with each other and bind to the E-box core sequence (3'-CANNTG-5') [ (PUBMED:15507434) (PUBMED:26240184) ].

GO process:regulation of transcription, DNA-templated (GO:0006355)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3371