The domain within your query sequence starts at position 228 and ends at position 353; the E-value for the DUF3371 domain shown below is 9.2e-36.
MQARAHGLSLIPSTGLCSPDLVNRIIKQEPVLENCSQELVQHQADLTCTTTLDLTDGTIT FTNNLGTMPESSPAYSIPRKMGSNLEDILMDDALSPVGVTDPLLSSVSPGASKTSSRRSS MSAEET
DUF3371 |
---|
PFAM accession number: | PF11851 |
---|---|
Interpro abstract (IPR021802): | This entry represents a domain found at the C terminus of the MiT/TFE family members, which include MITF (microphthalmia-associated transcription factor) and its related family members TFE3, TFEB and TFEC [ (PUBMED:7958932) ]. They are basic helix-loop-helix leucine zipper transcription factors found in chordata. These transcription factors heterodimerize with each other and bind to the E-box core sequence (3'-CANNTG-5') [ (PUBMED:15507434) (PUBMED:26240184) ]. |
GO process: | regulation of transcription, DNA-templated (GO:0006355) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3371