The domain within your query sequence starts at position 91 and ends at position 232; the E-value for the DUF3429 domain shown below is 1.5e-34.
LDSPKPALYITLAGLIPFTAPPLLMVITKSYIPVLAFTQMAYGAGFLAFLGGIRWGFVLP ESSPAKPDYINLASSMSPILFSWAAILFSERLNEAIVTLIIGLGIALHNELFLLPHYPNW FKALRIVSTLVAFISFVVTLIL
DUF3429 |
---|
PFAM accession number: | PF11911 |
---|---|
Interpro abstract (IPR021836): | This family of proteins are functionally uncharacterised. This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 147 to 245 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3429