The domain within your query sequence starts at position 36 and ends at position 126; the E-value for the DUF3446 domain shown below is 1.3e-27.
GKFSIDPQYPGASCYPEGIINIVSAGILQGVTPPASTTASSSVTSASPNPLATGPLGVCT MSQTQPELDHLYSPPPPPPPYSGCTGDLYQD
DUF3446 |
---|
PFAM accession number: | PF11928 |
---|---|
Interpro abstract (IPR021849): | Proteins containing this domain include early growth response protein 1/2/3 (EGR1/2/3). EGR1 is a transcriptional regulator that binds specifically to 9-bp target sequences containing two CpG sites that can potentially be methylated at four cytosine bases [ (PUBMED:25999311) ]. EGR2, also known as Krox20, is an E3 ligase that sumoylates its Nab coregulators [ (PUBMED:21836637) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3446