The domain within your query sequence starts at position 381 and ends at position 488; the E-value for the DUF3496 domain shown below is 1.6e-45.
VRTQMELRIKDLESEFSKMKSQVDCNQIEMENYKQLYLAEVKIRKSLSNKLSKTDERLAE VKTKLLLERKQYRASQYSMVDTRPALEPTCPRDSNKFFIPRSFSGEIM
DUF3496 |
---|
PFAM accession number: | PF12001 |
---|---|
Interpro abstract (IPR021885): | This presumed domain is functionally uncharacterised. This domain is found in eukaryotes. This domain is about 110 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3496