The domain within your query sequence starts at position 591 and ends at position 712; the E-value for the DUF3498 domain shown below is 4.2e-70.

HKQDLAVLQDKLRISTKKLEEYETLFKCQEETTQKLVLEYQARLEEGEERLRRQQEDKDI
QMKGIISRLMSVEEELKKDHAEMQAAVDSKQKIIDAQEKRIASLDAANARLMSALTQLKE
SM

DUF3498

DUF3498
PFAM accession number:PF12004
Interpro abstract (IPR021887):

This presumed domain can be found at the C terminus of Ras GTPase-activating proteins (RasGAPs). This domain is typically between 433 to 538 amino acids in length. It is found associated with the RasGAP domain ( IPR001936 ) and the C2 domain ( IPR000008 ). This domain has two conserved sequence motifs: DLQ and PLSFQNP.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3498