The domain within your query sequence starts at position 532 and ends at position 687; the E-value for the DUF3504 domain shown below is 4.5e-40.
YFSLSDEEEMWQAGCLGDDSPITLLSTVVKYNSQYLNMRTLQEHADLMYGDIELLKDPQN QPYFARTDSVKRESRSGSTRVCHGKIYHEHSRGHKQCPYCLLYKYMYIHRPPTQMEAKSP FYLTARKEATDMGSVWYEEQRMGLRSLRGIVPNLAR
DUF3504 |
---|
PFAM accession number: | PF12012 |
---|---|
Interpro abstract (IPR021893): | This presumed domain is functionally uncharacterised. This domain is found in eukaryotes. This domain is typically between 156 to 173 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3504