The domain within your query sequence starts at position 274 and ends at position 505; the E-value for the DUF3512 domain shown below is 1.6e-82.
REVISCMFEPEGNACSLTDSTAEEHVLALVEHAADEARDRINRFLPGGKMGYLKKLGDGS LLYSVVNAPEPDADEEETHPVDLSSLSSKLLPGFTTLGFKDERRNKVTFLSSASTALSMQ NNSVFGDLKSDEMELLYSAYGDETGVQCALSLQEFVKDAGSYSKKMVDDLLDQITGGDHS RMIFQLKQRRSIPMRPADEMKVGDPLGESGGPVLDFMSMKQYPDVSLDVSML
DUF3512 |
---|
PFAM accession number: | PF12024 |
---|---|
Interpro abstract (IPR021900): | This presumed domain is functionally uncharacterised. This domain is found in eukaryotes. This domain is typically between 231 to 249 amino acids in length. This domain is found associated with . |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3512