The domain within your query sequence starts at position 428 and ends at position 535; the E-value for the DUF3583 domain shown below is 1.4e-57.
LEQEASQTVGSMKRKCSHEDCSRKIIKMESTEENEDRLATSSPEQSWPSTFKATSPPHLD GTSNPESTVPEKKILLPNNNHVTSDTGETEERVVVISSSEDSDTENLS
DUF3583 |
![]() |
---|
PFAM accession number: | PF12126 |
---|---|
Interpro abstract (IPR021978): | This domain is found in eukaryotes, and is typically between 302 and 338 amino acids in length. It is found in association with IPR018957 and IPR000315 . Most members are promyelocytic leukemia proteins, and this family lies towards the C terminus. Proteins containing this domain include PML protein from mammals. PML (promyelocytic leukaemia) functions via its association with PML-nuclear bodies (PML-NBs) in a wide range of important cellular processes, including tumor suppression, transcriptional regulation, apoptosis, senescence, DNA damage response, and viral defense mechanisms [ (PUBMED:15356634) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3583