The domain within your query sequence starts at position 1494 and ends at position 1534; the E-value for the DUF3652 domain shown below is 9.3e-20.

QIIGIPKIIQLCDGIMASGRKAVTHAIPALQPIVHDLFVLR

DUF3652

• PFAM accession number: PF12372
• Interpro abstract (IPR024613):

  This repeated domain is less than 40 amino acids in length and is associated with the huntingtin protein. The protein is of unknown function, however it is known that an expansion of a polyglutamine (CAG) repeat in the gene coding for it results in the development of Huntington's disease.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3652