The domain within your query sequence starts at position 301 and ends at position 433; the E-value for the DUF3694 domain shown below is 1.1e-38.

YFSAVPKDKDRQCFKLRQGIDKKIVICVQQTANKELAIERCFGLLLSPGKDVRNSDMHLL
DLESMGKSSDGKSYVITGSWNPKSPHFQVVNEETPKDKVLFMTTAVDLVITEVQEPVRFL
LETKVRVCSPNER

DUF3694

• PFAM accession number: PF12473
• Interpro abstract (IPR022164):

  This domain is found in eukaryotes, and is typically between 131 and 151 amino acids in length. There is a single completely conserved residue W that may be functionally important. It is found in some kinesin-like proteins and in Rab GTPase-activating protein 1.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3694