The domain within your query sequence starts at position 120 and ends at position 192; the E-value for the DUF3699 domain shown below is 1.2e-32.
PSKTLELTRLLPLKFVKISVHDHEKQQLRLKLATGRTFYLQLCPSSDAREDLFCYWEKLV YLLRPPMTNCISN
DUF3699 |
![]() |
---|
PFAM accession number: | PF12480 |
---|---|
Interpro abstract (IPR022168): | This domain family is found in eukaryotes, and is approximately 80 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3699