The domain within your query sequence starts at position 89 and ends at position 148; the E-value for the DUF3715 domain shown below is 2.9e-20.

VRNEYLEKQFAAKRSEMREGGRHSRELEEHFCFLALPQADVMDVYQNGLSVGTSPLRILG

DUF3715

DUF3715
PFAM accession number:PF12509
Interpro abstract (IPR022188):

This domain is found in eukaryotes, and is approximately 170 amino acids in length. Proteins containing this domain include TASOR and FAM208B proteins.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3715