The domain within your query sequence starts at position 89 and ends at position 251; the E-value for the DUF3715 domain shown below is 1.6e-58.
VRNEYLEKQFAAKRSEMREGGRHSRELEEHFCFLALPQADVMDVYQNGLSVGTSPLRILG NPLLGVYLCRHVDIALSHACSRSVAVESIMIFKVLFGRIKKIQPSMDKNKVSLDPSPNFD CHMSRNMPSLKDTIELQAYNSMVYFYEYDYFSRPVDKPRQCLP
DUF3715 |
---|
PFAM accession number: | PF12509 |
---|---|
Interpro abstract (IPR022188): | This domain is found in eukaryotes, and is approximately 170 amino acids in length. Proteins containing this domain include TASOR and FAM208B proteins. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3715