The domain within your query sequence starts at position 81 and ends at position 216; the E-value for the DUF3736 domain shown below is 2.9e-21.
AEEPRGSSLSSESSPVSSPATNHSSPASTPKRVPMGPIIVPPGGHSVPSTPPVVTIAPTK TVNGVWRSESRQDSGSRGSSSGRERLLVEPPLAQEKAAGPAIPSHLLSTPYPFGLSPGSV VQDSRFQPLNLQRPVH
DUF3736 |
![]() |
---|
PFAM accession number: | PF12540 |
---|---|
Interpro abstract (IPR022207): | This domain is found in genetic suppressor element coiled-coil proteins. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3736