The domain within your query sequence starts at position 9 and ends at position 104; the E-value for the DUF3767 domain shown below is 5.4e-15.
ETEKKPFKLLGILDVENTPCARESILYGSLGSIVTGLGHFLVTSRIRRSCDVGVGGFILV TLGCWFHCRYNFAKQRIQERIAREGIKNKILYESTH
DUF3767 |
 |
|---|
| PFAM accession number: | PF12597 |
|---|---|
| Interpro abstract (IPR022533): | Complex IV (CIV) is a copper-heme oxidase that couples electron transfer from cytochrome c to oxygen with proton extrusion across the inner membrane to contribute to the proton gradient required for ATP generation. This entry includes fungal mitochondrial complex IV assembly factor Cox20 [ (PUBMED:10671482) ] and its homologues (also known as (FAM36A) in metazoa [ (PUBMED:23125284) ]. Human CIV is formed by three catalytic core subunits (COX1/2/3). COX20 has been found to form a complex with SCO1, SCO2, and newly synthetized COX2. It may act as a chaperone in the early steps of COX2 maturation [ (PUBMED:24403053) ]. |
| GO process: | mitochondrial cytochrome c oxidase assembly (GO:0033617) |
| GO component: | mitochondrial inner membrane (GO:0005743) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3767