The domain within your query sequence starts at position 119 and ends at position 294; the E-value for the DUF383 domain shown below is 4e-57.
CVLDPQWPWAEEAAAVLANLSREPAPCAALMEKLMAAEPERLGLERLVNALCTPSYNAAA PLHYLGPLLSNLSQQAEVRAFLLDPDRCVVQRLLPLTQYTDSSVRRGGVVGTLRNCCFEH RHHKWLLGAQVDILPFLLLPLAGPEEFSEEEMDQLPVDLQYLSPDKQREPDADIRK
DUF383 |
---|
PFAM accession number: | PF04063 |
---|---|
Interpro abstract (IPR007205): | This entry represents a domain within Protein HGH1, of unknown function. It is found N-terminal to another domain of unknown function ( IPR007206 ). |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF383