The domain within your query sequence starts at position 299 and ends at position 353; the E-value for the DUF384 domain shown below is 6.2e-22.

AVMLLTATAPGRKQVRDQGAYLILRELHSWEPEPDVRMACEKLIQVLIGDEPEAG

DUF384

 DUF384
PFAM accession number:PF04064
Interpro abstract (IPR007206):

This entry represents a domain within Protein HGH1, of unknown function. It is found C-terminal to another domain of unknown function ( IPR007205 ).

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF384