The domain within your query sequence starts at position 85 and ends at position 185; the E-value for the DUF4061 domain shown below is 4.3e-45.
VTDVYEMEGGLLNLLNDFHSGRLQAFGKECSFEQLEHVREMQEKLARLHFSLDVCGEEED EEEEEDGVTEGLPEEQKKTMADRNLDQLLSNLEDLSNSIQK
DUF4061 |
![]() |
---|
PFAM accession number: | PF13270 |
---|---|
Interpro abstract (IPR025271): | This entry includes CCDC28A and CCDC28B. CCDC28B modulates mTORC2 complex assembly and function, possibly enhances AKT1 phosphorylation [ (PUBMED:23727834) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4061