The domain within your query sequence starts at position 141 and ends at position 270; the E-value for the DUF4174 domain shown below is 2.2e-31.
ILASFAGKNRVWVISAPHASEGYYRLMMSLLKDDVYCELAERHIQQIVLFHQAGEEGGKV RRITNEGQILEQPLDPNLIPKLMSFLKLEKGKFSMVLLKKTLQVEERYPYPVRLEAMYEV IDQGPIRRIE
DUF4174 |
![]() |
---|
PFAM accession number: | PF13778 |
---|---|
Interpro abstract (IPR025232): | This domain of unknown function is found in a putative tumour suppressor gene [ (PUBMED:15563452) ] and in a ligand for the the urokinase-type plasminogen activator receptor, which plays a role in cellular migration and adhesion [ (PUBMED:18718938) (PUBMED:19667118) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4174