The domain within your query sequence starts at position 57 and ends at position 147; the E-value for the DUF4195 domain shown below is 1e-48.
IFVAEIASSKPAISNILNRVNPSSHSRGIKNGILNRGFTASFKPTSQRCLNSASNPVAAL PVNFHPESRSSDSSVIVQPFSKPGLIGSPFK
DUF4195 |
![]() |
---|
PFAM accession number: | PF13836 |
---|---|
Interpro abstract (IPR025243): | This domain is found at the N terminus of a number of proteins that carry PHD-like zinc-finger domains. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4195