The domain within your query sequence starts at position 98 and ends at position 211; the E-value for the DUF4196 domain shown below is 1.8e-50.
KHLTNTSNSSADEEQLKETKHNDLPDDEAHPGQAENHHNRHTGQILEEDMEDEYIKPGKR KRLSSVMYDSDESDDSDILIRKASAKHPRRVVEDECSSLEMEQETPEKSSAARK
DUF4196 |
---|
PFAM accession number: | PF13846 |
---|---|
Interpro abstract (IPR025244): | This short domain is found in Ccdc82 and homologous sequences. Its function is not known. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4196