The domain within your query sequence starts at position 112 and ends at position 230; the E-value for the DUF4200 domain shown below is 4.4e-28.
FINDQRDRFLLEYTVSTKKKTIKRFERLIAIKENQLKKAEKKLQDDALSFEEFLRENDQR SVDALKMAAQETINKLQMTSELKKASMEVQSIKSDIAKTEFLLKEYMKYGFFLLKLSPK
DUF4200 |
 |
|---|
| PFAM accession number: | PF13863 |
|---|---|
| Interpro abstract (IPR025252): | This entry represents a coiled-coil domain. Its function is unknown. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4200