The domain within your query sequence starts at position 394 and ends at position 570; the E-value for the DUF4201 domain shown below is 9.5e-53.
EDKKEKEMSAVRLENVQLKQSLVHFETRMKAQEDLAEGLLLIDFEQLKIENQTFNEKVEE RNEELLKLRTKVTSNVQIITHVKEKLSFIDTENSCKKAQLSEVDAQVALGRDLLTKTKQA RDSLRIDNVKLSQKCGLLGKESLLRDLEEKVEKTEMLNRRLESLKRHHAGLALSCKG
DUF4201 |
![]() |
---|
PFAM accession number: | PF13870 |
---|---|
Interpro abstract (IPR025254): | This is a family of coiled-coil proteins from eukaryotes. Their function is not known. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4201