The domain within your query sequence starts at position 119 and ends at position 150; the E-value for the DUF4203 domain shown below is 6.6e-12.

ALVCIMCCLFGVVYCFFGYRCFKAVLFLTGLL

DUF4203

 DUF4203
PFAM accession number:PF13886
Interpro abstract (IPR025256):

This domain of unknown function is often found in proteins from the transmembrane 7 superfamily.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4203