The domain within your query sequence starts at position 119 and ends at position 150; the E-value for the DUF4203 domain shown below is 6.6e-12.
ALVCIMCCLFGVVYCFFGYRCFKAVLFLTGLL
DUF4203 |
![]() |
---|
PFAM accession number: | PF13886 |
---|---|
Interpro abstract (IPR025256): | This domain of unknown function is often found in proteins from the transmembrane 7 superfamily. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4203