The domain within your query sequence starts at position 3 and ends at position 87; the E-value for the DUF4205 domain shown below is 1.3e-16.
EVTKELLELVWGTKSSPGLSDTIFCRWTQELLGIHEQAAVGFLTLMEALRYCKVGSYLKS PKFPIWIVGSETHLTVFFAKDMAL
DUF4205 |
---|
PFAM accession number: | PF13898 |
---|---|
Interpro abstract (IPR025257): | This is a conserved domain found in deubiquitinating enzymes, MINDY-3 and MINDY-4. Deubiquitinating enzymes (DUBs) remove ubiquitin (Ub) from Ub-conjugated substrates to regulate the functional outcome of ubiquitylation. This entry includes MINDY-3/4. They belong to the MINDY (motif interacting with Ub-containing novel DUB) family (peptidase family C121), whose members are deubiquitinating enzymes releasing Lys48-linked ubiquitin [ (PUBMED:27292798) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4205