The domain within your query sequence starts at position 1 and ends at position 118; the E-value for the DUF4477 domain shown below is 7.5e-48.
XSVLYSNHNRLGHHKPHLALRQVEQCLKRLKHMNLEGSIEDLSQLLSANATQPGATENRV VPSQPVVEVVLMKVLGGCKLLLRLLDCCCKAFLLTVKHLGLKEFIILNLVMVGLVSRL
DUF4477 |
---|
PFAM accession number: | PF14780 |
---|---|
Interpro abstract (IPR027951): | This entry represents a domain of unknown function in proteins from eukaryotes, including human uncharacterised protein C3orf17. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4477