The domain within your query sequence starts at position 41 and ends at position 111; the E-value for the DUF4490 domain shown below is 2.7e-15.
LDPKTLHTATSLSKAQMIMYKTSASQYGAFSPRPFFFPCKFLPQEQAFTEHLKTTGFYQN NSLNVGPDRTR
DUF4490 |
 |
|---|
| PFAM accession number: | PF14892 |
|---|---|
| Interpro abstract (IPR026507): | Proteins in this family may be up-regulated during progression from G1 to S phase of the cell cycle. Its maximal expression is during S or G2 phase [ (PUBMED:18182857) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4490