The domain within your query sequence starts at position 15 and ends at position 96; the E-value for the DUF4500 domain shown below is 8.3e-41.
LKEKNFENPGLRGAHTTTLFRAVNPELFIKPNKPVMAFGLVTLSLCVAYIGYLHATQENR KDLYEAIDSEGHRYMRRKTSKW
DUF4500 |
 |
|---|
| PFAM accession number: | PF14937 |
|---|---|
| Interpro abstract (IPR026686): | This entry consists of uncharacterised, single-pass membrane proteins. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4500