The domain within your query sequence starts at position 13 and ends at position 70; the E-value for the DUF4504 domain shown below is 7.3e-15.
AQQTLGMGKRKCPPRATCLHLAGEVLAVARGLKPAVLYDCNSAGVLALQSYLEELQGL
DUF4504 |
---|
PFAM accession number: | PF14953 |
---|---|
Interpro abstract (IPR027850): | This family of proteins is found in eukaryotes. Proteins in this family are typically between 253 and 329 amino acids in length. There are two conserved sequence motifs: LLGYP and SFS. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4504