SMART: Pfam domain DUF4506

The domain within your query sequence starts at position 59 and ends at position 198; the E-value for the DUF4506 domain shown below is 1.8e-60.

VSLKSSLSPRDENPCFIYLNCGPNGGEEILSVGVLSSARNMEVYLGEEYCGTSRGKTACT
VLDDSEHEKILLYKKYLKLDSPTHACKIKLLSFGEKQCVLVSKVVVHLRPRSADPSPRSA
ALGSRIDLDNIQTIMESMGS

DUF4506

PFAM accession number:	PF14958
Interpro abstract (IPR028043):	This family is found in eukaryotes. It represents the ATPase protein associated with ABC transporters (PAAT) and related proteins. PAAT is formed of a nucleotide-binding domain (NBD)-like domain and a signal for intramitochondrial sorting. PAAT interacts with the mitochondrial inner membrane ABC proteins: ABCB7, ABCB8, and ABCB10. It is involved in maintenance of mitochondrial homeostasis and cell survival [ (PUBMED:25063848) ].

PFAM accession number:

PF14958

Interpro abstract (IPR028043):

This family is found in eukaryotes. It represents the ATPase protein associated with ABC transporters (PAAT) and related proteins. PAAT is formed of a nucleotide-binding domain (NBD)-like domain and a signal for intramitochondrial sorting. PAAT interacts with the mitochondrial inner membrane ABC proteins: ABCB7, ABCB8, and ABCB10. It is involved in maintenance of mitochondrial homeostasis and cell survival [ (PUBMED:25063848) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4506