The domain within your query sequence starts at position 2 and ends at position 72; the E-value for the DUF4512 domain shown below is 1.3e-16.
VCIPCIVIPVLLWIFKKFLEPYIYPVVSRIWPKKAVQQSGDKNMSKVDCKGAGTNGLPTK GPTEVSDKKKD
DUF4512 |
 |
|---|
| PFAM accession number: | PF14975 |
|---|---|
| Interpro abstract (IPR026776): | This entry represents a family of uncharacterised proteins. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4512