The domain within your query sequence starts at position 30 and ends at position 177; the E-value for the DUF4517 domain shown below is 1.6e-56.
QSHVHFDEKLHDSVVMVTQESDNSFLVKVGFLKILHRYEITFTLPPVRRLSKDIRETPVH SLHLKLLSVTPTSEGYSIKCEYSAHKEGVLKEEMLLACEGDIGTCVRVTVQARVMDRHHG TPMLLDGVKCVGAELEYDSEQSDWLGFD
DUF4517 |
---|
PFAM accession number: | PF15006 |
---|---|
Interpro abstract (IPR026794): | This entry represents a family of uncharacterised proteins. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4517