The domain within your query sequence starts at position 451 and ends at position 542; the E-value for the DUF4520 domain shown below is 8.6e-37.
ILPVLLKESLIPGVGRFLAYSDDKVHAVFLDGVTVTLNWHLSSSAEKKQVDQGLSFGWCR LTFPDGQDQLIPTEHPGAYERYVTSVISWCRG
DUF4520 |
 |
|---|
| PFAM accession number: | PF15016 |
|---|---|
| Interpro abstract (IPR027865): | This is the C-terminal domain of a family of eukaryotic proteins. Proteins in this family are typically between 197 and 638 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4520