The domain within your query sequence starts at position 1 and ends at position 117; the E-value for the DUF4522 domain shown below is 9.7e-66.
MAYGLPRRNTVQTILKGSCYKVQEPWDLAELTKTWYTNLTNIRLPFLGEIVFGSPMNLLA SQTKQECQFPSMQSMALEKEYEAKRLTKLKCQENVCKEIQASLREKKVGLRRPLQPK
DUF4522 |
 |
|---|
| PFAM accession number: | PF15022 |
|---|---|
| Interpro abstract (IPR027825): | This family of mammalian proteins is functionally uncharacterised. In humans, this protein is known as C4orf36. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4522