The domain within your query sequence starts at position 34 and ends at position 199; the E-value for the DUF4523 domain shown below is 1.1e-89.
NLHKLLPNHLVEVLHSYRSEEDKNKCEKPEFSGLEKILARHQLPKEISLSPKPSLMPSWR RRIINNISGNWKKCHLWQKSTYEPPMGTIVARWTKKNLQPTEDLKSVIQRLSALGPIISV TPSGRQSAVVVFRDITSACKAVSAFQSMSGGSMFQCSWQHRFMAKN
DUF4523 |
![]() |
---|
PFAM accession number: | PF15023 |
---|---|
Interpro abstract (IPR027827): | This family of proteins is functionally uncharacterised. This family of proteins is found in mammals. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4523