The domain within your query sequence starts at position 9 and ends at position 154; the E-value for the DUF4524 domain shown below is 5e-61.
MVLYEDDSVQVHYACGSTLQLSPCGSEFLFEKALPPSTHPLEQPERIRQRTHFVISNYRE QLQRALDFRNSSATCPFLSESIIPPERKKHIFIDFSEVEWPSLDRDDCIMYSESGVVKIT SLDGHAYLCLPRSQHEFTVHFLCKVS
DUF4524 |
---|
PFAM accession number: | PF15025 |
---|---|
Interpro abstract (IPR027830): | This is the N-terminal domain of a family of eukaryotic proteins. Proteins in the family are typically between 197 and 638 amino acids in length. The human gene is from C5orf34. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4524