The domain within your query sequence starts at position 3 and ends at position 137; the E-value for the DUF4525 domain shown below is 9.3e-64.
FFSPWKLSSQKLGFFLVTFGFIWGMMLLHFTIQQRTQPESSSMLREQILDLSKRYIKALA EENRDVVDGPYAGVMTAYDLKKTLAVLLDNILQRIGKLESKVDNLVNGTGANSTNSTTAV PSLVSLEKINVADII
DUF4525 |
![]() |
---|
PFAM accession number: | PF15027 |
---|---|
Interpro abstract (IPR027833): | This domain is found in eukaryotes. It is often found at the N terminus of glycosyltransferase family 18 enzymes. It is also found in coiled-coil domain-containing protein 126. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4525