The domain within your query sequence starts at position 3 and ends at position 135; the E-value for the DUF4527 domain shown below is 4.5e-41.
PTFQAKLASLVHKCQERNRLIEHLLQELPRHEPRNRLLSELAQNMLEDIALAEYSATFLT PGAPEMFCHLDVSSKETLAGGGQCTCQKPFCLFSRSQGQVGWVQTAQCQTCTMKGTSSLS LSFCCSTVLPPHS
DUF4527 |
---|
PFAM accession number: | PF15030 |
---|---|
Interpro abstract (IPR032771): | This family of proteins is functionally uncharacterised. This family of proteins is found in vertebrates. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4527