The domain within your query sequence starts at position 63 and ends at position 101; the E-value for the DUF4535 domain shown below is 3.4e-12.
SAVLGFAVGTCTGIYAAQAYAVPNVEKALKNYFRSLRKG
DUF4535 |
![]() |
---|
PFAM accession number: | PF15054 |
---|---|
Interpro abstract (IPR027854): | STMP1 may be a subunit of mitochondrial respiratory complexes [ (PUBMED:23073385) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4535