The domain within your query sequence starts at position 12 and ends at position 146; the E-value for the DUF4542 domain shown below is 5.8e-56.
EKSFVLDGVAVSTMAQAYSIMRPKLWSAIPPYNPQLDHHSRRYFRSRVVPPILRKTDQDH GGTGRDGWIVDYFHIFGQGQRYLNRRNWAGAGHSLQQVSGHDYYNSNPKAITTGLNGRFG YRRNTPALRQHTSVF
DUF4542 |
---|
PFAM accession number: | PF15075 |
---|---|
Interpro abstract (IPR028027): | This family of proteins is found in eukaryotes. Proteins in this family are typically between 123 and 173 amino acids in length. There is a conserved IPPYN sequence motif. The gene that encodes this protein in humans, is found in the chromosomal position, C17orf98. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4542