The domain within your query sequence starts at position 20 and ends at position 105; the E-value for the DUF4558 domain shown below is 1.3e-34.
RAVALKKTVDRWRNFHIHCMWQTTLDQRRNLFAALRMKDTKEQELALSNKQLLVVRQAAL HELFEKEYQQYQQELNQMGKAFYEER
DUF4558 |
---|
PFAM accession number: | PF15104 |
---|---|
Interpro abstract (IPR029375): | This entry represents a group of eukaryotic proteins that are typically between 78 and 121 amino acids in length. Proteins in this entry including human C1orf189 protein. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4558