The domain within your query sequence starts at position 18 and ends at position 128; the E-value for the DUF4562 domain shown below is 7e-48.
IVTGPDYVKDHLPKVHQHTAYIGEKRPALEKTGDLRYLWRPASNRSLPAKYKHEYTCGIG WGIPQYSFFNRSRVESGFHIQHGELSLRAMDKITHRYQNPCKQEHGPWGSS
DUF4562 |
---|
PFAM accession number: | PF15123 |
---|---|
Interpro abstract (IPR027814): | This family of proteins is found in eukaryotes and is functionally uncharacterised. Members of the family contain a conserved HRYQNPW sequence motif. This family includes the human protein C4orf45 ( Q96LM5 ). |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4562