The domain within your query sequence starts at position 95 and ends at position 251; the E-value for the DUF4573 domain shown below is 4.6e-60.
ATDHSRPTKKIEPLVQGGECEQPQPGGKDDMLGTEEVKKDVEARTEVPSLKGDAEIKPLR LSSERDSPGAPQAGTMKFLQTAENILPLETTQELPPKEATGKGAQPQILEAIPKENSSPE IEGIQSAESSGQQQLVEAPGEAEQPQALETVLKENET
DUF4573 |
![]() |
---|
PFAM accession number: | PF15140 |
---|---|
Interpro abstract (IPR027856): | This entry represents a group of uncharacterised proteins, including glutamate-rich protein 5. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4573