The domain within your query sequence starts at position 102 and ends at position 217; the E-value for the DUF4590 domain shown below is 9.8e-62.
VHLSYDDIDFRDEIKIYQQHCGGENLCVYKGKLLEKDTFQFISKRHHGFPFSLTFFLNGI QVNRISSCCEFKHRRSTRLGGKRGYFGFVCVEKASPCYRCIIAMGLDRKPSSTKPK
DUF4590 |
---|
PFAM accession number: | PF15257 |
---|---|
Interpro abstract (IPR027962): | This family remains to be characterised. It is found in eukaryotes, and includes human protein C1orf173. In this family of proteins there are two conserved sequence motifs: CCE and PCY. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4590