The domain within your query sequence starts at position 300 and ends at position 413; the E-value for the DUF4590 domain shown below is 2.6e-58.

HLSYDDIDFRDEIKIYQQHCGGENLCVYKGKLLEKDTFQFISKRHHGFPFSLTFFLNGIQ
VNRISSCCEFKHRRSTRLGGKRGYFGFVCVEKASPCYRCIIAMGLDRKPSSTKP

DUF4590

DUF4590
PFAM accession number:PF15257
Interpro abstract (IPR027962):

This family remains to be characterised. It is found in eukaryotes, and includes human protein C1orf173. In this family of proteins there are two conserved sequence motifs: CCE and PCY.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4590