The domain within your query sequence starts at position 203 and ends at position 378; the E-value for the DUF4594 domain shown below is 1.1e-63.
PLEESERDRREGSRRHGRNWGGSDFERVRSGLEQERQGRRAGLGSGGDMTMSMTGRERSE YLRWKQEREKIDQERLQRHRKPTGQWRREWDAEKTDGMFKDGPAPTHELSHRYDDQAWAR PPKPPTFGEFLSQHKAEVSSRRRRKNSRPQAKVAPRAYSDHDNRWETREEAVSSAP
DUF4594 |
![]() |
---|
PFAM accession number: | PF15266 |
---|---|
Interpro abstract (IPR029336): | This entry represents a group of eukaryotic proteins that are typically between 170 and 183 amino acids in length. In humans, the gene encoding this protein lies in the position, chromosome 15 open reading frame 52. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4594