The domain within your query sequence starts at position 1053 and ends at position 1098; the E-value for the DUF4596 domain shown below is 4.1e-27.

ELGRWAELLSPLDESRASITSVTSFSPDDVASPQGDWTVVEVETFH

DUF4596

• PFAM accession number: PF15363
• Interpro abstract (IPR027907):

  This domain is found in vertebrates. It is found at the C terminus of some uncharacterised proteins. It contains a conserved ELET sequence motif and two completely conserved residues (S and E) that may be functionally important.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4596