The domain within your query sequence starts at position 93 and ends at position 155; the E-value for the DUF4597 domain shown below is 2.5e-43.

MCVSSSNNNHDEAPVLNDKHLSVPNIIITPPTPTGMGLSRDSNKQVWMDELGSYQDDGEL
EPE

DUF4597

DUF4597
PFAM accession number:PF15366
Interpro abstract (IPR027864):

This family of proteins is found in eukaryotes. Proteins in this family are typically between 63 and 76 amino acids in length. There is a conserved TPPTPT sequence motif.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4597