The domain within your query sequence starts at position 1 and ends at position 56; the E-value for the DUF4599 domain shown below is 1.4e-15.

MKSQSWVPKQGNVRQLLCLDPSCQICEAATEEIQQLVQSEKSQLSPAFLGLNQGSA

DUF4599

DUF4599
PFAM accession number:PF15371
Interpro abstract (IPR027970):

This domain of unknown function is found in proteins described as spermatogenesis-associated protein 31 (SPATA31).

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4599